search
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Welcome to Wagner Models
$0.00
John Gawlik House 1:87
John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87 John Gawlik House 1:87

John Gawlik House 1:87

$5.00 inc. tax
Description

Model in pdf format for self-printing.

The model contains:

5 sheets with parts
1 sheet with instruction
1 sheet with description
1 sheet with cover

Details
Product Code: MJ03
Brand: Monika Jantar Models
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
(write review)
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i