GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
The Search For Mister Lloyd
The Search For Mister Lloyd
Product Code:SFML
Product Condition:New
£7.99 inc. tax
Add to Cart
Description
Where do you even begin to search for your lost pigeon? Of course you put up LOST posters, pinning them to as many tree trunks as possible and handing them out to people in the street, but its not like you can actually look for a pigeon... or can you?

Mister Lloyd fails to return home from his first international race much to the distress of Mostyn Price, a young pigeon fancier from North Wales. His grandfather presumes hes been devoured by a falcon but Mostyn is hell-bent on proving him wrong, determined to conquer his sense of loss, especially as his own dad also vanished a few years earlier.

A mysterious tip-off suggests Mister Lloyd has landed in London and the search shifts to the metropolis where the 11-year-old hero finds himself increasingly isolated and in danger.
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i