USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Love Esquire: Dakimakura
Units in Stock
95
Notify me when product is back in stock
Product Code:LE06-DAKIMAKURA
Product Condition:New
$120.00 inc. tax
Add to Cart
Description
A physical, double-sided dakimakura of your Love Esquire waifu. Happy hugging! ❤

Specifications:
  • Printed in maximum quality (2way tricot).
  • Measures about 50cmx160cm.
  • This is a pillow case only. Actual pillow is not included.

*Please note that images shown may differ from the final product.
*Please don't forget to read our FAQ for shipping info and other details.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i