USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Love Esquire: Keychain
Units in Stock
90
Notify me when product is back in stock
Product Code:LE05-KEYCHAIN
Product Condition:New
$10.00 inc. tax
Add to Cart
Description
A cute keychain! Strap it on and bring it wherever you go!

Specifications:
  • About 2 inches (height).
  • Double-sided, clear acrylic keychain.
  • Metal split ring as hook.
  • Comes with cardboard backing.
  • Has a protective layer that prevents scratches. This is optional, and you may remove it to give your keychain a shinier and smoother finish.

*Please note that images shown may differ from the final product.
*Please don't forget to read our FAQ for shipping info and other details.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i