USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
The Letter: Keychain
Units in Stock
83
Notify me when product is back in stock
Product Code:TL08-KEYCHAIN
Product Condition:New
$10.00 inc. tax
Add to Cart
Description
A cute keychain! Strap it on and bring it wherever you go!

Specifications:
  • About 2 inches (height).
  • Double-sided, clear acrylic keychain.
  • Metal split ring as hook.
  • Comes with cardboard backing.
  • Has a protective layer that prevents scratches. This is optional, and you may remove it to give your keychain a shinier and smoother finish.

*Please note that images shown may differ from the final product.
*Please don't forget to read our FAQ for shipping info and other details.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i