search
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Welcome to So Faded Chic
$0.00
PAYMENT:
•We use PayPal to process all payments, but you do not need to have a PayPal account. Please follow the PayPal prompts to choose your preferred method:
••Sign in to use your PayPal account   OR   Without signing in:
••Use your preferred Credit/Debit Card or eCheck
•Please make sure your street SHIPPING ADDRESS is showing correctly in the PAYMENT PAGE because we ONLY ship to the address associated with the payment, and many items can NOT ship to a P.O. Box.
Thank you.

PAYMENT:
•All payment methods (PayPal, Credit/Debit Card, eCheck) are processed by PayPal, but you do not need to have a PayPal account. Please follow the PayPal prompts to choose your preferred method:
••Sign in to use your PayPal account   OR   Without signing in:
••Use your preferred Credit/Debit Card or eCheck (AKA Transfer from your Bank Account)
•Please make sure your street DELIVERY ADDRESS is showing correctly in the PAYMENT PAGE because we ONLY ship to the shipping address associated with the payment, and many items can NOT ship to a P.O. box.
Thank you.




Notify me when product is back in stock
Circle One Xpose Minimal Red 7ft 2

Circle One Xpose Minimal Red 7ft 2

$8,450.00 inc. tax
Description
  • Length: 7' 2'
  • Width: 21½'
  • Thickness: 2½'
  • Construction: EPS Pressurised core
  • Conditions: Ripple to Head High
  • Fins: Xpose 5 Fin - Surfinz

High volume fun board that is a great progression to a more responsive board. It is both forgiving and can harness the ride qualities of a performance board with the stability of a mini-mal. Constructed with durable EPS Pressurised core with a Gloss Lacquer Finish and a Unidirectional full length wood stringer for strength and controlled flex. Also features reinforced rails, nose and tail to protect from dings and ensure lifespan. This board comes set-up with 5 Super-tough Surfinz fins and Finbox units.

Details
Product Code: DEMOC
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i