search
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Welcome to So Faded Chic
$0.00
PAYMENT:
•We use PayPal to process all payments, but you do not need to have a PayPal account. Please follow the PayPal prompts to choose your preferred method:
••Sign in to use your PayPal account   OR   Without signing in:
••Use your preferred Credit/Debit Card or eCheck
•Please make sure your street SHIPPING ADDRESS is showing correctly in the PAYMENT PAGE because we ONLY ship to the address associated with the payment, and many items can NOT ship to a P.O. Box.
Thank you.

PAYMENT:
•All payment methods (PayPal, Credit/Debit Card, eCheck) are processed by PayPal, but you do not need to have a PayPal account. Please follow the PayPal prompts to choose your preferred method:
••Sign in to use your PayPal account   OR   Without signing in:
••Use your preferred Credit/Debit Card or eCheck (AKA Transfer from your Bank Account)
•Please make sure your street DELIVERY ADDRESS is showing correctly in the PAYMENT PAGE because we ONLY ship to the shipping address associated with the payment, and many items can NOT ship to a P.O. box.
Thank you.




Notify me when product is back in stock
TIKI Nitrous PU Clear/Blue 6ft8

TIKI Nitrous PU Clear/Blue 6ft8

$9,999.00 inc. tax
Description
Board Features
  • Length: 6’8”
  • Width: 21'
  • Thickness: 2' 3/4'
  • Construction: PU
  • Volume: 45.3 ltr
  • Conditions: 1 - 4ft
  • Fins: 3 Fins FCS

The Nitrous is a development of Tiki's best selling fish model.

They have widened the tail block with the effect of straightening the rail line and increasing the tail area.

This creates 3 main differences

  • better wave catching from immediate pick-up
  • more stability at the back foot, with a wider platform to drive off
  • more speed from a straighter rail and larger planing surface.

The result is a board that catches waves better and delivers effortless speed.

Details
Product Code: DEMOB
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i